PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15257.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 248aa    MW: 27565.7 Da    PI: 4.7323
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15257.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB155.87.5e-4961154295
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              +e+++++Pianv+rim+++lP  akis+dake+vqecvse+isf+t+ea+++cq+e+rkt++++d+lwa+++lGf+dy+epl+++l
  mrna15257.1-v1.0-hybrid  61 HEHNQYMPIANVIRIMRRILPLYAKISDDAKEIVQECVSEYISFITGEANEHCQQEQRKTVTAEDVLWAMGKLGFDDYIEPLSLFL 146
                              689*********************************************************************************** PP

                    NF-YB  88 kkyreleg 95 
                              +kyre+eg
  mrna15257.1-v1.0-hybrid 147 TKYREAEG 154
                              *****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.8E-4559160IPR009072Histone-fold
SuperFamilySSF471135.43E-3565160IPR009072Histone-fold
PfamPF008082.3E-2466130IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.2E-1694112No hitNo description
PRINTSPR006158.2E-16113131No hitNo description
PRINTSPR006158.2E-16132150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MDPMNDLDRV CNNINNHEKS ITASESDPNQ VIDTNNPNEV NISRGNNVEV VSPRQPVQIV  60
HEHNQYMPIA NVIRIMRRIL PLYAKISDDA KEIVQECVSE YISFITGEAN EHCQQEQRKT  120
VTAEDVLWAM GKLGFDDYIE PLSLFLTKYR EAEGINRNSF FMKRERGDGR RKENAMRGHY  180
RPLGLALAEQ QPGVYEPGAM SGSYRDGEEG GSGSGGVGPI SPFLSQGQGE SFVGGGLDPF  240
AQFKLQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3662151493NF-YB
4csr_A3e-3662151594NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B3e-3662151594NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293185.10.0PREDICTED: nuclear transcription factor Y subunit B-8-like
TrEMBLA0A0H3XVU24e-62A0A0H3XVU2_VERFO; Nuclear transcription factor Y subunit B-14
STRINGGLYMA20G00240.11e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3301522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-53nuclear factor Y, subunit B6